Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

SAB1412316

Sigma-Aldrich

ANTI-T antibody produced in mouse

clone 2A12, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

MGC104817, T, TFT

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2A12, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen 36.63 kDa

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... T(6862)

Description générale

The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. (provided by RefSeq)

Immunogène

T (NP_003172, 222 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Diana L Castillo-Carranza et al.
Journal of Alzheimer's disease : JAD, 40 Suppl 1, S97-S111 (2014-03-08)
Neurodegenerative disease is one of the greatest health crises in the world and as life expectancy rises, the number of people affected will continue to increase. The most common neurodegenerative disease, Alzheimer's disease, is a tauopathy, characterized by the presence
T B Smith et al.
Andrology, 2(5), 755-762 (2014-08-02)
We have shown previously that a network of mononuclear phagocytes (MPs) expressing macrophage and dendritic cell markers such as CD11c, F4/80 and CX3CR1, lines the base of the epididymal tubule. However, in the initial segment (IS) and only in that
Jessica Oenarto et al.
Archives of biochemistry and biophysics, 560, 59-72 (2014-07-09)
This study characterizes the expression of the osmolyte transporters betaine/γ-amino-n-butyric acid (GABA) transporter (BGT-1), the taurine transporter (TauT) and the sodium-dependent myo-inositol transporter (SMIT) in various rat brain cells in culture and in rat and human cerebral cortex in situ.
Akiko Ohtani et al.
Neuroscience research, 81-82, 11-20 (2014-04-05)
Serotonin (5-HT) regulates the development of cerebral cortex, but 5-HT receptors mediating the effects are poorly understood. We investigated roles of 5-HT2A receptor in dendritic growth cones using dissociation culture of rat cerebral cortex. Neurons at embryonic day 16 were
Olga Wiens et al.
PloS one, 9(7), e103821-e103821 (2014-08-01)
The invasion of Theileria sporozoites into bovine leukocytes is rapidly followed by the destruction of the surrounding host cell membrane, allowing the parasite to establish its niche within the host cell cytoplasm. Theileria infection induces host cell transformation, characterised by

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique