SAB1404744

Monoclonal Anti-ABCG1 antibody produced in mouse

clone 2H8, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : ABC8, MGC34313, WHITE1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 2H8, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~38.1 kDa
• Espèces réactives: human
• Technique(s): capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable
• Isotype: IgG1
• Numéro d'accès NCBI: BC029158
• Numéro d'accès UniProt: P45844
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Informations sur le gène: human ... ABCG1(9619)

Description

Description générale

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified. (provided by RefSeq)

Immunogène

ABCG1 (AAH29158, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNI

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable