SAB1400187

Monoclonal Anti-NME2 antibody produced in mouse

clone 1D3, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-MGC111212, Anti-NDPKB, Anti-NM23B, Anti-NM23H2, Anti-puf
• Numéro MDL: MFCD01865221
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 1D3, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human, mouse, rat
• Technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotype: IgG3κ
• Numéro d'accès UniProt: P22392
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Informations sur le gène: human ... NME2(4831)

Description

Description générale

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of ′A′ (encoded by NME1) and ′B′ (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. (provided by RefSeq)

Immunogène

NME2 (NP_002503, 51 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable