HPA026797

Anti-DGKQ antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-DAGK, Anti-DAGK4, Anti-DAGK7, Anti-diacylglycerol kinase
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA026797
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunohistochemistry: 1:20- 1:50
• Séquence immunogène: HVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSG
• Numéro d'accès UniProt: P52824
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... DGKQ(1609)

Description

Description générale

Diacylglycerol kinase θ (DGKθ) of 941 amino acids with molecular mass of ~ 110 kDa is encoded by a gene mapped to human chromosome 4p16.3. DGKθ, also known as diacylglycerol kinase 4 (DAGK4), belongs to group V of DGK protein family. It is characterized with three cysteine-rich domains, N-terminal proline/ glycine-rich domain, a pleckstrin homology domain and Ras-associating domain. DGKθ needs polybasic cofactor and acidic phospholipids for its absolute activity. DGKθ is highly expressed in brain and at low level in the small intestine, duodenum and liver.

Immunogène

diacylglycerol kinase, theta 110kDa recombinant protein epitope signature tag (PrEST)

Application

Anti-DGKQ antibody produced in rabbit has been used in western blotting. All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Actions biochimiques/physiologiques

Diacylglycerol kinase theta (DGKθ) plays a vital role in synthesizing phosphatidic acid (PA) ligand for the nuclear receptor steroidogenic factor 1 (SF1) and functions in the regulation of adrenocortical steroidogenesis. DGKθ expression is essential for SF1/cAMP (cyclic adenosine monophosphate) stimulated CYP17A1 (Cytochrome P450 17A1) transcription and it also promotes steroid hormone production in human adrenocortical cells.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST86847

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable