HPA010851
Anti-OSTM1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonyme(s) :
Anti-Osteopetrosis-associated transmembrane protein 1 precursor antibody produced in rabbit
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Gamme de produits
Prestige Antibodies® Powered by Atlas Antibodies
Forme
buffered aqueous glycerol solution
Espèces réactives
human
Validation améliorée
recombinant expression
Learn more about Antibody Enhanced Validation
Technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
Séquence immunogène
REAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVEDAMNITRKLWSRTFNCSVP
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... OSTM1(28962)
Description générale
OSTM1 (osteopetrosis associated transmembrane protein 1) is one of the genes associated with Autosomal Recessive Osteopetrosis (ARO) in humans. It was first identified in murine model, as the gene associated with grey-lethal mutant mice. This protein is thought to be an E3 ubiquitin ligase as well as a Gα-interacting protein. It is a type II transmembrane protein, which resides in intracellular compartments. In mice, this gene encodes a protein with predicted 338 amino acids. The region between N- and C- termini of the protein is hydrophobic, and shows slight homology to RING-finger proteins. It also has many putative N-linked glycosylation sites. OSTM1 is expressed in multiple tissues such as, osteoclasts, brain, liver and kidney.
Immunogène
Osteopetrosis-associated transmembrane protein 1 precursor recombinant protein epitope signature tag (PrEST)
Application
Anti-OSTM1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Actions biochimiques/physiologiques
The exact function of OSTM1 (osteopetrosis associated transmembrane protein 1) gene is not yet known. However, it acts as a β subunit for the protein ClC-7 (Chloride channel 7), as it co-localizes with ClC-7 in lysosomes and late endosomes in multiple tissues, as well as in the bone-resorbing osteoclasts, in their ruffled borders. This gene is essential for the maturation and normal function of osteocytes and melanocytes. In humans, mutations in this gene lead to autosomal recessive osteopetrosis (ARO). ARO is a rare hereditary disorder, which is a result of oscteoclast resorption failure, and is characterized by bone marrow failure, increased bone density and fractures. OSTM1 is also responsible for normal neural development, and mutations in this gene lead to ARO with severe neuronopathy. This phenotype is characterized by malformations in the central nervous system, blindness, seizures, and deafness.
Caractéristiques et avantages
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Liaison
Corresponding Antigen APREST71674
Forme physique
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informations légales
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Équipement de protection individuelle
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Claus-Eric Ott et al.
Bone, 55(2), 292-297 (2013-05-21)
Autosomal recessive osteopetrosis (ARO, MIM 259700) is a genetically heterogeneous rare skeletal disorder characterized by failure of osteoclast resorption leading to pathologically increased bone density, bone marrow failure, and fractures. In the neuronopathic form neurological complications are especially severe and
Philipp F Lange et al.
Nature, 440(7081), 220-223 (2006-03-10)
Mutations in ClC-7, a late endosomal/lysosomal member of the CLC family of chloride channels and transporters, cause osteopetrosis and lysosomal storage disease in humans and mice. Severe osteopetrosis is also observed with mutations in the OSTM1 gene, which encodes a
Alessandra Pangrazio et al.
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, 21(7), 1098-1105 (2006-07-04)
We report three novel osteopetrosis patients with OSTM1 mutations and review two that have been previously described. Our analysis suggests that OSTM1 defines a new subset of patients with severe central nervous system involvement. This defect is also present in
Bruno Maranda et al.
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, 23(2), 296-300 (2007-10-10)
Infantile ARO is a genetic disorder characterized by osteoclast dysfunction that leads to osteopetrosis. We describe a novel mutation affecting the OSTM1 locus responsible for ARO. In addition to common clinical features of osteopetrosis, the patient developed a unique neuronal
Amitabha Majumdar et al.
Molecular biology of the cell, 22(10), 1664-1676 (2011-03-29)
Incomplete lysosomal acidification in microglia inhibits the degradation of fibrillar forms of Alzheimer's amyloid β peptide (fAβ). Here we show that in primary microglia a chloride transporter, ClC-7, is not delivered efficiently to lysosomes, causing incomplete lysosomal acidification. ClC-7 protein
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique