HPA023600

Anti-AFP antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Alpha-1-fetoprotein, Anti-Alpha-fetoglobulin, Anti-Alpha-fetoprotein
• MDL-Nummer: MFCD00162111
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA023600
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: ITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVA
• UniProt-Hinterlegungsnummer: P02771
• Anwendung(en): research pathology
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... AFP(174)

Beschreibung

Allgemeine Beschreibung

The gene AFP (alpha fetoprotein) encodes a plasma glycoprotein that has a molar mass of 70kDa. The gene is mapped to human chromosome 4. The gene is evolutionarily-related to serum albumin, which is also mapped to human chromosome 4.It is synthesized along with serum albumin during the development of embryonic yolk sac and the liver.

Immunogen

Alpha-fetoprotein Precursor recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

Alpha-fetoprotein encoded by the gene AFP is involved in the regulation of fatty acids in both fetal and proliferating adult liver cells. Its expression is found to be increased in acute liver injuries, indicating active liver regeneration. It has been associated with fatty liver disease (FLD), a disease that may lead to cirrhosis and hepatocellular carcinoma. It serves as a tumor marker for HCC (hepatocellular carcinoma).

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST86804

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable