AV44398

Anti-ZDHHC13 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-FLJ10852, Anti-FLJ10941, Anti-HIP14L, Anti-HIP3RP, Anti-MGC64994, Anti-Zinc finger, DHHC-type containing 13
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 54 kDa
• Speziesreaktivität: mouse, guinea pig, rat, human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_061901
• UniProt-Hinterlegungsnummer: Q8IUH4-3
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... ZDHHC13(54503)

Beschreibung

Allgemeine Beschreibung

Zinc finger, DHHC-type containing 13 (ZDHHC13, HIP14L, HIP3RP) is a Huntingtin-interacting protein that mediates the dual functions of palmitoyl acyltransferase and Mg²⁺ transport qualifying it as a chanzyme. Protein palmitoylation is important for the regulation of important cellular processes such as protein trafficking, stability, and protein-protein interactions. Improper palmitoylation may underlie diseases such as human alopecia, osteoporosis, and amyloidosis and many other neurodegenerative diseases caused by protein misfolding and amyloidosis.

Spezifität

Anti-ZDHHC13 polyclonal antibody reacts with chicken, human, mouse, rat, zebrafish, and bovine zinc finger, DHHC-type containing 13 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZDHHC13

Anwendung

Anti-ZDHHC13 polyclonal antibody is used to tag zinc finger, DHHC-type containing 13 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of zinc finger, DHHC-type containing 13 in processes that involve Mg²⁺ transport and protein palmitoylation.

Biochem./physiol. Wirkung

ZDHHC13 may be involved in the NF-kappa-B signaling pathway.

Sequenz

Synthetic peptide located within the following region: MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable