Accéder au contenu
MilliporeSigma
Toutes les photos(3)

Documents

SAB1402233

Sigma-Aldrich

Monoclonal Anti-HSPA4 antibody produced in mouse

clone 3A11, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

APG-2, HS24/P52, MGC131852, RY, hsp70, hsp70RY

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3A11, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~42.39 kDa

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

BC002526

Numéro d'accès UniProt

P34932

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... HSPA4(3308)

Catégories apparentées

Immunogène

HSPA4 (AAH02526, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID

Actions biochimiques/physiologiques

Hspa4 (heat shock protein family A (Hsp70) member 4) is an important ATP-dependent cytosolic chaperone along with Hsp90. Hspa4 aids in the folding of several proteins and helps in protecting against cellular stresses such as rise in temperature. Hspa4 maintains the function of the mitotic centrosome to coordinates bipolar mitotic spindle assembly. Hspa4 might compensate the loss of parkin function in mice by protecting the cells against proteolytic and mitochondrial stress. Therefore, it can serve as an important therapeutic agent for parkinson disease. Upregulation of HSPA4 is observed in parkin gene knockout mice. Hspa4 is known to be associated with tumor progression and offers resistance against many therapeutic agents. The gene is upregulated in many different types of cancer.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Cheng-Wu Zhang et al.
Neuro-degenerative diseases, 16(5-6), 304-316 (2016-02-18)
Mutations of parkin are a prevalent genetic contributor to familial Parkinson's disease (PD). As a key regulator of protein and mitochondrial homeostasis, parkin plays a pivotal role in maintaining dopaminergic neuronal survival. However, whereas Drosophila parkin null mutants exhibit prominent
Chieh-Ting Fang et al.
Cellular and molecular life sciences : CMLS, 73(20), 3949-3960 (2016-05-04)
To establish a functional bipolar mitotic spindle, the centrosome expands and matures, acquiring enhanced activities for microtubule (MT) nucleation and assembly at the onset of mitosis. However, the regulatory mechanisms of centrosome maturation and MT assembly from the matured centrosome
Tomohiko Harada et al.
Pancreatology : official journal of the International Association of Pancreatology (IAP) ... [et al.], 9(1-2), 13-24 (2008-12-17)
Microarray-based comparative genomic hybridisation (CGH) has allowed high-resolution analysis of DNA copy number alterations across the entire cancer genome. Recent advances in bioinformatics tools enable us to perform a robust and highly sensitive analysis of array CGH data and facilitate
Induction of Hsp70 in tumor cells treated with inhibitors of the Hsp90 activity: A predictive marker and promising target for radiosensitization.
Kudryavtsev VA, et.al.
PLoS ONE, 12(3), 1-25 (2017)
Vladimir A Kudryavtsev et al.
PloS one, 12(3), e0173640-e0173640 (2017-03-16)
We studied a role of the inducible heat shock protein 70 (Hsp70) in cellular response to radiosensitizing treatments with inhibitors of the heat shock protein 90 (Hsp90) chaperone activity. Cell lines derived from solid tumors of different origin were treated
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique