Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV04001

Sigma-Aldrich

Anti-MyC (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Myc protein

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

49 kDa

species reactivity

mouse, human, dog, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MYC(4609)

Immunogen

Synthetic peptide directed towards the C terminal region of human MYC

Application

Protein lysates of mouse forebrains were analyzed by western blot using rabbit anti-myc. In addition, immunocytochemistry of PC12 cells fixed in 4% paraformaldhyde was performed using rabbit anti-myc at a 1:500 dilution and 4 degrees incubation overnight.

Biochem/physiol Actions

MyC is an immediate early response protein that is regulated by multiple signal transduction pathways. It is a highly amplified oncogene in many human cancers and is commonly found altered by chromosomal translocations. MyC plays a role in tumor initiation, proliferation of cells and tumor maintenance.

Sequence

Synthetic peptide located within the following region: APKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Chi V Dang
Cell, 149(1), 22-35 (2012-04-03)
The MYC oncogene contributes to the genesis of many human cancers. Recent insights into its expression and function have led to therapeutic opportunities. MYC's activation by bromodomain proteins could be inhibited by drug-like molecules, resulting in tumor inhibition in vivo. Tumor
David Cappellen et al.
EMBO reports, 8(1), 70-76 (2006-12-13)
The developmental and oncogenic roles of MYC proteins are well established, but the transcriptional targets mediating their functions remain elusive. Using small interfering RNA-mediated knockdown in breast and cervix carcinoma cell lines, which overexpress c-MYC, we show that c-MYC independently
Francisco Ciruela et al.
The European journal of neuroscience, 32(8), 1265-1277 (2010-09-18)
The stimulation of inhibitory neurotransmitter receptors, such as γ-aminobutyric acid type B (GABA(B) ) receptors, activates G protein-gated inwardly-rectifying K(+) (GIRK) channels, which influence membrane excitability. There is now evidence suggesting that G protein-coupled receptors and G protein-gated inwardly-rectifying K(+)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service