SAB5703019

Anti-ABCE1 Antibody, clone 1N4I7, Rabbit Monoclonal

• Sinônimo(s): ABC38, OABP, RLI, RLI1, RNASEL1, RNASELI, RNS4I
• Código UNSPSC: 12352203

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 1N4I7, monoclonal
• forma: liquid
• peso molecular: 67 kDa
• reatividade de espécies: mouse, mouse
• concentração: 1.50 mg/mL
• técnica(s): immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: AARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
• nº de adesão UniProt: P61221
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ABCE1(6059)

Descrição

Descrição geral

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Imunogênio

A synthetic peptide corresponding to a sequence within amino acids 500-599 of human ABCE1 (P61221).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Aplicação

WB, IF/ICC

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1