SAB2100667

Anti-EIF4G1 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-DKFZp686A1451, Anti-EIF4F, Anti-EIF4G, Anti-Eukaryotic translation initiation factor 4 γ, 1, Anti-P220
• Número MDL: MFCD01633313
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 175 kDa
• reatividade de espécies: human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão UniProt: Q04637
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... EIF4G1(1981)

Descrição

Imunogênio

Synthetic peptide directed towards the middle region of human EIF4G1

Ações bioquímicas/fisiológicas

EIF4G1 is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5′-terminal secondary structure, and recruitment of mRNA to the ribosome.The protein encoded by this gene is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5′-terminal secondary structure, and recruitment of mRNA to the ribosome. Alternative splicing results in five transcript variants encoding four distinct isoforms.

Sequência

Synthetic peptide located within the following region: PAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQ

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable