SAB1402307

Monoclonal Anti-PGK1, (C-terminal) antibody produced in mouse

clone 2H4, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): MGC117307, MGC142128, MGC8947, MIG10, PGKA
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2H4, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~36.41 kDa
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_000291
• nº de adesão UniProt: P00558
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PGK1(5230)

Descrição

Descrição geral

The protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. This gene lies on the X-chromosome, while a related pseudogene also has been found on the X-chromosome and another on chromosome 19. (provided by RefSeq) Phosphoglycerate kinase 1 (PGK1) is a glycolytic enzyme. The gene encoding it is localized on human chromosome X.

Imunogênio

PGK1 (NP_000282, 321 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI

Ações bioquímicas/fisiológicas

Phosphoglycerate kinase 1 (PGK1) converts 1, 3-diphosphoglycerate to 3-phosphoglycerate. Mitochondrial PGK1 phosphorylates pyruvate dehydrogenase kinase 1. PGK1 may have a role in rheumatoid arthritis. The protein is upregulated in various cancers. It is regulated by hypoxia-inducible factor-1α. It also has a role in DNA repair and angiogenesis. Deficiency of the enzyme is linked to combinations of hemolytic anemia, neurological dysfunction and myopathy.

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable