Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

WH0153769M1

Sigma-Aldrich

Monoclonal Anti-SH3RF2 antibody produced in mouse

clone 4E10, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-FLJ23654, Anti-MGC90410, Anti-RNF158, Anti-SH3 domain containing ring finger 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

4E10, monoclonal

Forme

buffered aqueous solution

Espèces réactives

mouse, rat, human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

NM_152550

Numéro d'accès UniProt

Q8TEC5

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SH3RF2(153769)

Immunogène

SH3RF2 (NP_660205, 640 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VKTVRFQNYSPPPTKHYTSHPTSGKPEQPATLKASQPEAASLGPEMTVLFAHRSGCHSGQQTDLRRKSALAKATTLVSTASGTQTVFPSK

Actions biochimiques/physiologiques

SH3 domain containing ring finger 2 (SH3RF2) binds to protein phosphatase 1 in vitro. It is an anti-apoptotic protein which negatively regulates c-Jun N-terminal kinase (JNK) pathway and also associates with p21-activated kinase 4. SH3RF2 has been shown to be upregulated in cancers.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Chun-Yu Chen et al.
Biochemical and biophysical research communications, 391(1), 698-702 (2009-12-01)
In this report, we identified the novel protein heart protein phosphatase 1-binding protein (Hepp1), encoded by FLJ23654. Hepp1 associated with protein phosphatase 1 (PP1) by yeast two-hybrid, GST pull-down, co-immunoprecipitation, and far Western blotting assays. Northern blot analysis revealed that
Michael Wilhelm et al.
The Journal of biological chemistry, 287(3), 2247-2256 (2011-12-01)
We report that Sh3rf2, a homologue of the pro-apoptotic scaffold POSH (Plenty of SH3s), acts as an anti-apoptotic regulator for the c-Jun N-terminal kinase (JNK) pathway. siRNA-mediated knockdown of Sh3rf2 promotes apoptosis of neuronal PC12 cells, cultured cortical neurons, and
Tae Woo Kim et al.
Carcinogenesis, 35(3), 624-634 (2013-10-17)
SH3RF (SH3-domain-containing RING finger protein) family members, SH3RF1-3, are multidomain scaffold proteins involved in promoting cell survival and apoptosis. In this report, we show that SH3RF2 is an oncogene product that is overexpressed in human cancers and regulates p21-activated kinase

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique