SAB1400139
Anti-IL6 antibody produced in mouse
IgG fraction of antiserum, buffered aqueous solution
Synonyme(s) :
Anti-BSF2, Anti-HGF, Anti-HSF, Anti-IFNB2, Anti-IL6
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
mouse
Conjugué
unconjugated
Forme d'anticorps
IgG fraction of antiserum
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Espèces réactives
human
Technique(s)
immunofluorescence: suitable
western blot: 1 μg/mL
Numéro d'accès UniProt
Conditions d'expédition
dry ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... IL6(3569)
Description générale
Human IL-6 (Interleukin-6) gene maps to chromosome 7p15. It is found to be mainly expressed in lymphoid and non-lymphoid cells, such as T-cells, B-cells, monocytes, fibroblasts, keratinocytes, endothelial cells and mesangium cells. It encodes a 184 amino acid protein that contains two potential N-glycosylation sites and four cysteine residues.
This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. (provided by RefSeq)
This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. (provided by RefSeq)
Immunogène
IL6 (AAH15511, 1 a.a. ~ 212 a.a) full-length human protein.
Sequence
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Sequence
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Actions biochimiques/physiologiques
IL-6 (Interleukin-6) is a proinflammatory cytokine that plays an important role in the maturation of B cells into antibody producing cells. It is also expressed by resting T-cells and induces IL-2 receptor and IL-2 production n mitogen-stimulated T cells and thymocytes. IL-6 functions in the activation and proliferation of T-cells. It participates in hematopoiesis by activating hematopoietic stem cells at the G0 stage to enter into the G1 phase. Increased levels of IL-6 and C-reactive protein have been observed in type-2 diabetes mellitus.
Forme physique
Solution in phosphate buffered saline, pH 7.4
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Outil de sélection de produits.
En option
Réf. du produit
Description
Tarif
Code de la classe de stockage
10 - Combustible liquids
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Les clients ont également consulté
The biology of interleukin-6.
Hirano T.
Interleukins : molecular biology and immunology, 51, 153-180 (1992)
The biology of interleukin-6.
Hirano T.
INTERNATIONAL CONFERENCE OF COMPUTATIONAL METHODS IN SCIENCES AND ENGINEERING 2009:(ICCMSE 2009)., 51, 153-180 (1992)
A D Pradhan et al.
JAMA, 286(3), 327-334 (2001-07-24)
Inflammation is hypothesized to play a role in development of type 2 diabetes mellitus (DM); however, clinical data addressing this issue are limited. To determine whether elevated levels of the inflammatory markers interleukin 6 (IL-6) and C-reactive protein (CRP) are
Lorena Oróstica et al.
Reproductive sciences (Thousand Oaks, Calif.), 27(1), 290-300 (2020-02-13)
A pro-inflammatory environment is characteristic of obesity and polycystic ovary syndrome (PCOS). This environment through cytokines secretion negatively affects insulin action. Endometria from women with both conditions (obesity and PCOS) present high TNF-α level and altered insulin signaling. In addition
Hagen Maxeiner et al.
Journal of cellular physiology, 229(11), 1681-1689 (2014-03-14)
Cardiosphere-derived cells (CDCs) were cultured from human, murine, and rat hearts. Diluted supernatant (conditioned-medium) of the cultures improved the contractile behavior of isolated rat cardiomyocytes (CMCs). This effect is mediated by the paracrine release of cytokines. The present study tested
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique