SAB2108953

Anti-IL4I1 (C-terminal) antibody produced in rabbit HRP conjugated

affinity isolated antibody

• Synonym(s): C25H
• UNSPSC Code: 12352203
• NACRES: NA.43

Properties

• biological source: rabbit
• conjugate: peroxidase conjugate
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 61 kDa
• species reactivity (predicted by homology): human
• concentration: 0.5 mg/mL
• NCBI accession no.: NM_152899
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... IL4I1(259307)

Description

General description

The protein encoded by this gene shares the limited similarity with L-amino acid oxidase, and contains the conserved key amino acid residues thought to be involved in catalysis and binding of the flavin adenine dinucleotide cofactor. The expression of this gene can be induced by interleukin 4 in B cells. Two alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported.

Immunogen

Synthetic peptide directed towards the C-terminal region of Human IL4I1

Sequence

Synthetic peptide located within the following region: PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable