SAB1403477

Monoclonal Anti-NKX2-3, (N-terminal) antibody produced in mouse

clone 4F4, purified immunoglobulin, buffered aqueous solution

• Synonym(e): CSX3, NK2.3, NKX2.3, NKX2C, NKX4-3
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 4F4, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~32.27 kDa
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_145285
• UniProt-Hinterlegungsnummer: Q8TAU0
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... NKX2-3(159296)

Beschreibung

Allgemeine Beschreibung

NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM

Immunogen

NKX2-3 (NP_660328.1, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFS

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable