AV43692

Anti-ABCB9 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-ATP-binding cassette, sub-family B (MDR/TAP), member 9, Anti-EST122234, Anti-KIAA1520, Anti-TAPL
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 80 kDa
• Speziesreaktivität: rat, bovine, dog, human, mouse
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_982269
• UniProt-Hinterlegungsnummer: Q9NP78
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... ABCB9(23457)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human ABCB9

Biochem./physiol. Wirkung

ABCB9 belongs to the ATP-binding cassette (ABC) transporters superfamily and is involved in transport of molecules across extra- and intra-cellular membranes. It is reportedly associated with the lysosomes at high levels in testes and moderate levels in brain and spinal cord.

Sequenz

Synthetic peptide located within the following region: RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable