APREST81568

PrEST Antigen CLPX

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• UNSPSC-Code: 12352202

Eigenschaften

• Rekombinant: expressed in E. coli
• Qualitätsniveau: 100
• Assay: >80% (SDS-PAGE)
• Form: buffered aqueous solution
• Mol-Gew.: predicted mol wt 28 kDa
• Aufgereinigt durch: immobilized metal affinity chromatography (IMAC)
• Konzentration: ≥0.5 mg/mL
• Immunogene Sequenz: GRLGTFETQILQRAPLRSFTETPAYFASKDGISKDGSGDGNKKSASEGSSKKSGSGNSGKGGNQLRCPKCGDLCTHVETFVSSTRFVKCEKCHH
• Ensembl | Human Hinterlegungsnummer: ENSG00000166855
• UniProt-Hinterlegungsnummer: O76031
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... CLPX(10845)

Beschreibung

Allgemeine Beschreibung

Recombinant protein fragment of Human CLPX with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Anwendung

Suitable as a blocking agent using corresponding antibodies.

Verlinkung

Corresponding Antibody HPA040262.

Physikalische Form

Solution in 1 M urea-PBS, pH 7.4

Angaben zur Herstellung

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Rechtliche Hinweise

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 2
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable