SAB5702818

Anti-S100P Antibody, clone 1E1M2, Rabbit Monoclonal

• Sinónimos: MIG9
• UNSPSC Code: 12352203

Propiedades

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 1E1M2, monoclonal
• form: liquid
• mol wt: 9 kDa
• species reactivity: human
• concentration: 1.00 mg/mL
• technique(s): immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:1000
• color: colorless
• isotype: IgG
• immunogen sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
• UniProt accession no.: P25815
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... S100P(6286)

Descripción

General description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer.

Immunogen

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human S100P (NP_005971.1).

Application

WB, IF/ICC

Información de seguridad

• pictograms: GHS07,GHS09
• signalword: Warning
• hcodes: H317 - H411
• pcodes: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Hazard Classifications: Aquatic Chronic 2 - Skin Sens. 1
• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3